General Information

  • ID:  hor002420
  • Uniprot ID:  C7FDI3
  • Protein name:  Myosuppressin
  • Gene name:  NA
  • Organism:  Rhodnius prolixus (Triatomid bug)
  • Family:  Myosuppressin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rhodnius (genus), Triatominae (subfamily), Reduviidae (family), Reduvioidea (superfamily), Cimicomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  QDIDHVFMRF
  • Length:  10(75-84)
  • Propeptide:  MILAWMCVTLLAGVLAAPGPDCSPSALQVQSSRVRNMCALYQISSALQAYLDEQNNYQTALRDTNIPYNIPEKRQDIDHVFMRFGRRR
  • Signal peptide:  MILAWMCVTLLAGVLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit spontaneous contraction of muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: inhibition of contraction for hindgut : 1.3*10(-9)moll; for heart : 6*10(-9)moll
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C7FDI3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002420_AF2.pdbhor002420_ESM.pdb

Physical Information

Mass: 146821 Formula: C59H86N16O16S
Absent amino acids: ACEGKLNPSTWY Common amino acids: DF
pI: 5.41 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 4
Hydrophobicity: -20 Boman Index: -2529
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 68
Instability Index: 2072 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  22623197
  • Title:  An Unusual Myosuppressin From the Blood-Feeding Bug Rhodnius Prolixus